OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LRRC20 (NM_207119) Human Mass Spec Standard

Be the first to review this product
SKU
PH305227
LRRC20 MS Standard C13 and N15-labeled recombinant protein (NP_997002)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344895 Rabbit Polyclonal Anti-LRRC20 Antibody - middle region
100 ul
$585.00
LY404053 Transient overexpression lysate of leucine rich repeat containing 20 (LRRC20), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "LRRC20 or NM_207119"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205227
Predicted MW 20.5 kDa
Protein Sequence
Protein Sequence
>RC205227 protein sequence
Red=Cloning site Green=Tags(s)

MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFM
TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKL
AAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997002
RefSeq Size 3428
RefSeq ORF 552
Locus ID 55222
UniProt ID Q8TCA0
Cytogenetics 10q22.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LRRC20" proteins (5)
SKU Description Size Price
LC404053 Lyophilized LRRC20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413250 Lyophilized LRRC20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404053 Transient overexpression lysate of leucine rich repeat containing 20 (LRRC20), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY413250 Transient overexpression lysate of leucine rich repeat containing 20 (LRRC20), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305227 Recombinant protein of human leucine rich repeat containing 20 (LRRC20), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products