OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COQ10B (NM_025147) Human Mass Spec Standard

Be the first to review this product
SKU
PH305174
COQ10B MS Standard C13 and N15-labeled recombinant protein (NP_079423)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375000 COQ10B Rabbit polyclonal Antibody
100 ul
$410.00
LY410865 Transient overexpression lysate of coenzyme Q10 homolog B (S. cerevisiae) (COQ10B), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "COQ10B or NM_025147"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205174
Predicted MW 27.1 kDa
Protein Sequence
Protein Sequence
>RC205174 protein sequence
Red=Cloning site Green=Tags(s)

MAARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAP
LINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVV
TLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVA
AFERRACKLYGPETNIPRELMLHEVHHT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079423
RefSeq Size 1989
RefSeq ORF 714
Locus ID 80219
UniProt ID Q9H8M1
Cytogenetics 2q33.1
Summary Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COQ10B" proteins (3)
SKU Description Size Price
LC410865 Lyophilized COQ10B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410865 Transient overexpression lysate of coenzyme Q10 homolog B (S. cerevisiae) (COQ10B), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP305174 Recombinant protein of human coenzyme Q10 homolog B (S. cerevisiae) (COQ10B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products