OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SNRPG (NM_003096) Human Mass Spec Standard

Be the first to review this product
SKU
PH305113
SNRPG MS Standard C13 and N15-labeled recombinant protein (NP_003087)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA372714 SNRPG rabbit polyclonal antibody
100 ul
$310.00
LY401078 Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide G (SNRPG) (as WB positive control) 100 ug
$436.00

Other products for "SNRPG or NM_003096"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205113
Predicted MW 8.5 kDa
Protein Sequence
Protein Sequence
>RC205113 protein sequence
Red=Cloning site Green=Tags(s)

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML
EALERV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003087
RefSeq Size 606
RefSeq ORF 228
Synonyms Sm-G; SMG
Locus ID 6637
UniProt ID P62308
Cytogenetics 2p13.3
Summary The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participates in the processing of the 3' end of histone transcripts. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Nov 2015
Protein Families Druggable Genome
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SNRPG" proteins (3)
SKU Description Size Price
LC401078 Lyophilized SNRPG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401078 Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide G (SNRPG) (as WB positive control) 100 ug
$436.00
TP305113 Recombinant protein of human small nuclear ribonucleoprotein polypeptide G (SNRPG), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products