OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MIF (NM_002415) Human Mass Spec Standard

Be the first to review this product
SKU
PH305106
MIF MS Standard C13 and N15-labeled recombinant protein (NP_002406)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA303028 Goat Polyclonal Antibody against MIF
100 ug
$565.00
LY400864 Transient overexpression lysate of macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) (as WB positive control) 100 ug
$436.00

Other products for "MIF or NM_002415"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205106
Predicted MW 12.5 kDa
Protein Sequence
Protein Sequence
>RC205106 protein sequence
Red=Cloning site Green=Tags(s)

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG
AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002406
RefSeq Size 561
RefSeq ORF 345
Synonyms GIF; GLIF; MMIF
Locus ID 4282
UniProt ID P14174
Cytogenetics 22q11.23
Summary This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Phenylalanine metabolism, Tyrosine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MIF" proteins (4)
SKU Description Size Price
LC400864 Lyophilized MIF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400864 Transient overexpression lysate of macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) (as WB positive control) 100 ug
$436.00
TP305106 Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), 20 µg 20 ug
$867.00
TP721165 Purified recombinant protein of Human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products