OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NUDCD2 (NM_145266) Human Mass Spec Standard

Be the first to review this product
SKU
PH305036
NUDCD2 MS Standard C13 and N15-labeled recombinant protein (NP_660309)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA359305 NUDCD2 Antibody - C-terminal region
100 ul
$585.00
LY407991 Transient overexpression lysate of NudC domain containing 2 (NUDCD2) (as WB positive control) 100 ug
$436.00

Other products for "NUDCD2 or NM_145266"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205036
Predicted MW 17.7 kDa
Protein Sequence
Protein Sequence
>RC205036 protein sequence
Red=Cloning site Green=Tags(s)

MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDST
IADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAE
ISGNYTKGGPDFSNLEK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660309
RefSeq Size 977
RefSeq ORF 471
Synonyms NudCL2
Locus ID 134492
UniProt ID Q8WVJ2
Cytogenetics 5q34
Summary May regulate the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NUDCD2" proteins (3)
SKU Description Size Price
LC407991 Lyophilized NUDCD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407991 Transient overexpression lysate of NudC domain containing 2 (NUDCD2) (as WB positive control) 100 ug
$436.00
TP305036 Recombinant protein of human NudC domain containing 2 (NUDCD2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products