OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TWIST2 (NM_057179) Human Mass Spec Standard

Be the first to review this product
SKU
PH305006
TWIST2 MS Standard C13 and N15-labeled recombinant protein (NP_476527)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403298 Transient overexpression lysate of twist homolog 2 (Drosophila) (TWIST2) (as WB positive control) 100 ug
$436.00

Other products for "TWIST2 or NM_057179"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205006
Predicted MW 18.1 kDa
Protein Sequence
Protein Sequence
>RC205006 protein sequence
Red=Cloning site Green=Tags(s)

MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL
ANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER
LSYAFSVWRMEGAWSMSASH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_476527
RefSeq Size 1186
RefSeq ORF 480
Synonyms AMS; BBRSAY; bHLHa39; DERMO1; FFDD3; SETLSS
Locus ID 117581
UniProt ID Q8WVJ9
Cytogenetics 2q37.3
Summary The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found. provided by RefSeq, Apr 2014
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TWIST2" proteins (3)
SKU Description Size Price
LC403298 Lyophilized TWIST2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403298 Transient overexpression lysate of twist homolog 2 (Drosophila) (TWIST2) (as WB positive control) 100 ug
$436.00
TP305006 Recombinant protein of human twist homolog 2 (Drosophila) (TWIST2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products