OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VAMP5 (NM_006634) Human Mass Spec Standard

Be the first to review this product
SKU
PH304973
VAMP5 MS Standard C13 and N15-labeled recombinant protein (NP_006625)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808605 VAMP5 mouse monoclonal antibody,clone OTI7F2 100 ul
$447.00
LY416522 Transient overexpression lysate of vesicle-associated membrane protein 5 (myobrevin) (VAMP5) (as WB positive control) 100 ug
$436.00

Other products for "VAMP5 or NM_006634"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204973
Predicted MW 12.8 kDa
Protein Sequence
Protein Sequence
>RC204973 protein sequence
Red=Cloning site Green=Tags(s)

MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR
ICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006625
RefSeq Size 694
RefSeq ORF 348
Locus ID 10791
UniProt ID O95183
Cytogenetics 2p11.2
Summary Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VAMP5" proteins (3)
SKU Description Size Price
LC416522 Lyophilized VAMP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416522 Transient overexpression lysate of vesicle-associated membrane protein 5 (myobrevin) (VAMP5) (as WB positive control) 100 ug
$436.00
TP304973 Recombinant protein of human vesicle-associated membrane protein 5 (myobrevin) (VAMP5), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products