OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Torsin B (TOR1B) (NM_014506) Human Mass Spec Standard

Be the first to review this product
SKU
PH304937
TOR1B MS Standard C13 and N15-labeled recombinant protein (NP_055321)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA341941 Rabbit Polyclonal Anti-TOR1B Antibody
100 ul
$525.00
LY415210 Transient overexpression lysate of torsin family 1, member B (torsin B) (TOR1B) (as WB positive control) 100 ug
$436.00

Other products for "Torsin B or NM_014506"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204937
Predicted MW 38 kDa
Protein Sequence
Protein Sequence
>RC204937 protein sequence
Red=Cloning site Green=Tags(s)

MLRAGWLRGAAALALLLAARVVAAFEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKL
DLEEKLFGQHLATEVIFKALTGFRNNKNPKKPLTLSLHGWAGTGKNFVSQIVAENLHPKGLKSNFVHLFV
STLHFPHEQKIKLYQDQLQKWIRGNVSACANSVFIFDEMDKLHPGIIDAIKPFLDYYEQVDGVSYRKAIF
IFLSNAGGDLITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSGLIDKNLIDYFIPFLPLE
YRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDKGCKTVQSRLDFH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055321
RefSeq Size 2774
RefSeq ORF 1008
Synonyms DQ1
Locus ID 27348
UniProt ID O14657
Cytogenetics 9q34.11
Summary The protein encoded by this gene is an ATPase found primarily in the endoplasmic reticulum and nuclear envelope. This gene has a highly-similar neighboring gene, TOR1A, that encodes a protein that is likely to interact in a complex with this protein. Finally, this protein may act as a chaperone and play a role in maintaining the integrity of the nuclear envelope and endoplasmic reticulum. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene. provided by RefSeq, Dec 2015
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Torsin B" proteins (3)
SKU Description Size Price
LC415210 Lyophilized TOR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415210 Transient overexpression lysate of torsin family 1, member B (torsin B) (TOR1B) (as WB positive control) 100 ug
$436.00
TP304937 Recombinant protein of human torsin family 1, member B (torsin B) (TOR1B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products