OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C12orf43 (NM_022895) Human Mass Spec Standard

Be the first to review this product
SKU
PH304834
C12orf43 MS Standard C13 and N15-labeled recombinant protein (NP_075046)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA361803 C12ORF43 Antibody - middle region
100 ul
$585.00
LY411468 Transient overexpression lysate of chromosome 12 open reading frame 43 (C12orf43) (as WB positive control) 100 ug
$436.00

Other products for "C12orf43 or NM_022895"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204834
Predicted MW 28.3 kDa
Protein Sequence
Protein Sequence
>RC204834 protein sequence
Red=Cloning site Green=Tags(s)

MAAPSGTVSDSESSNSSSDAEELERCREAAMPAWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHE
QDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQ
PRRKRQPSSSSSEDSDEEWRRCREAAVSASDILQESAIHSPGTVEKEAKKKRKLKKKAKKVASVDSAVAA
TTPTSMATVQKQKSGELNGDQVSLGTKKKKKAKKASETSPFPPAKSATAIPAN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_075046
RefSeq Size 2548
RefSeq ORF 789
Synonyms Custos
Locus ID 64897
UniProt ID Q96C57
Cytogenetics 12q24.31
Summary Plays a role in the regulation of Wnt signaling pathway during early development.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C12orf43" proteins (3)
SKU Description Size Price
LC411468 Lyophilized C12orf43 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411468 Transient overexpression lysate of chromosome 12 open reading frame 43 (C12orf43) (as WB positive control) 100 ug
$436.00
TP304834 Recombinant protein of human chromosome 12 open reading frame 43 (C12orf43), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products