HSPC014 (POMP) (NM_015932) Human Mass Spec Standard
CAT#: PH304812
POMP MS Standard C13 and N15-labeled recombinant protein (NP_057016)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204812 |
Predicted MW | 15.8 kDa |
Protein Sequence |
>RC204812 protein sequence
Red=Cloning site Green=Tags(s) MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNI QGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL L myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057016 |
RefSeq Size | 1477 |
RefSeq ORF | 423 |
Synonyms | C13orf12; HSPC014; PNAS-110; PRAAS2; UMP1 |
Locus ID | 51371 |
UniProt ID | Q9Y244 |
Cytogenetics | 13q12.3 |
Summary | The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.[provided by RefSeq, Aug 2010] |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402471 | POMP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402471 | Transient overexpression lysate of proteasome maturation protein (POMP) |
USD 436.00 |
|
TP304812 | Recombinant protein of human proteasome maturation protein (POMP), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review