OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSPC014 (POMP) (NM_015932) Human Mass Spec Standard

Be the first to review this product
SKU
PH304812
POMP MS Standard C13 and N15-labeled recombinant protein (NP_057016)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357335 POMP Antibody - C-terminal region
100 ul
$585.00
LY402471 Transient overexpression lysate of proteasome maturation protein (POMP) (as WB positive control) 100 ug
$436.00

Other products for "HSPC014 or NM_015932"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204812
Predicted MW 15.8 kDa
Protein Sequence
Protein Sequence
>RC204812 protein sequence
Red=Cloning site Green=Tags(s)

MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNI
QGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL
L

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057016
RefSeq Size 1477
RefSeq ORF 423
Synonyms C13orf12; HSPC014; PNAS-110; PRAAS2; UMP1
Locus ID 51371
UniProt ID Q9Y244
Cytogenetics 13q12.3
Summary The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.provided by RefSeq, Aug 2010
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSPC014" proteins (3)
SKU Description Size Price
LC402471 Lyophilized POMP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402471 Transient overexpression lysate of proteasome maturation protein (POMP) (as WB positive control) 100 ug
$436.00
TP304812 Recombinant protein of human proteasome maturation protein (POMP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products