OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CEP20 (NM_144600) Human Mass Spec Standard

Be the first to review this product
SKU
PH304756
C16orf63 MS Standard C13 and N15-labeled recombinant protein (NP_653201)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408241 Transient overexpression lysate of chromosome 16 open reading frame 63 (C16orf63) (as WB positive control) 100 ug
$436.00

Other products for "CEP20 or NM_144600"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204756
Predicted MW 19.8 kDa
Protein Sequence
Protein Sequence
>RC204756 protein sequence
Red=Cloning site Green=Tags(s)

MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTA
SVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLG
RQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653201
RefSeq Size 2250
RefSeq ORF 522
Synonyms C16orf63; FOPNL; FOR20; PHSECRG2
Locus ID 123811
UniProt ID Q96NB1
Cytogenetics 16p13.11
Summary Involved in the biogenesis of cilia (PubMed:20551181). Required for the recruitement of PLK1 to centrosomes and S phase progression (PubMed:24018379).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CEP20" proteins (3)
SKU Description Size Price
LC408241 Lyophilized FOPNL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408241 Transient overexpression lysate of chromosome 16 open reading frame 63 (C16orf63) (as WB positive control) 100 ug
$436.00
TP304756 Recombinant protein of human chromosome 16 open reading frame 63 (C16orf63), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products