OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LHFPL6 (NM_005780) Human Mass Spec Standard

Be the first to review this product
SKU
PH304687
LHFP MS Standard C13 and N15-labeled recombinant protein (NP_005771)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY417068 Transient overexpression lysate of lipoma HMGIC fusion partner (LHFP) (as WB positive control) 100 ug
$436.00

Other products for "LHFPL6 or NM_005780"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204687
Predicted MW 21.6 kDa
Protein Sequence
Protein Sequence
>RC204687 protein sequence
Red=Cloning site Green=Tags(s)

MASSLTCTGVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGR
YASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYP
LGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005771
RefSeq Size 2180
RefSeq ORF 600
Synonyms LHFP
Locus ID 10186
UniProt ID Q9Y693
Cytogenetics 13q13.3-q14.11
Summary This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. This gene is fused to a high-mobility group gene in a translocation-associated lipoma. Mutations in another LHFP-like gene result in deafness in humans and mice. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. provided by RefSeq, Jul 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LHFPL6" proteins (3)
SKU Description Size Price
LC417068 Lyophilized LHFP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417068 Transient overexpression lysate of lipoma HMGIC fusion partner (LHFP) (as WB positive control) 100 ug
$436.00
TP304687 Recombinant protein of human lipoma HMGIC fusion partner (LHFP), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products