OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SS18L2 (NM_016305) Human Mass Spec Standard

Be the first to review this product
SKU
PH304667
SS18L2 MS Standard C13 and N15-labeled recombinant protein (NP_057389)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY414076 Transient overexpression lysate of synovial sarcoma translocation gene on chromosome 18-like 2 (SS18L2) (as WB positive control) 100 ug
$436.00

Other products for "SS18L2 or NM_016305"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204667
Predicted MW 8.8 kDa
Protein Sequence
Protein Sequence
>RC204667 protein sequence
Red=Cloning site Green=Tags(s)

MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRGNECVQYQHVLHRNLIYLATIADASPT
STSKAME

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057389
RefSeq Size 822
RefSeq ORF 231
Synonyms KIAA-iso
Locus ID 51188
UniProt ID Q9UHA2
Cytogenetics 3p22.1
Summary Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L2 gene is homologous to SS18.supplied by OMIM, Jul 2002
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SS18L2" proteins (3)
SKU Description Size Price
LC414076 Lyophilized SS18L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414076 Transient overexpression lysate of synovial sarcoma translocation gene on chromosome 18-like 2 (SS18L2) (as WB positive control) 100 ug
$436.00
TP304667 Recombinant protein of human synovial sarcoma translocation gene on chromosome 18-like 2 (SS18L2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products