OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SULT2B1 (NM_177973) Human Mass Spec Standard

Be the first to review this product
SKU
PH304478
SULT2B1 MS Standard C13 and N15-labeled recombinant protein (NP_814444)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350464 Rabbit Polyclonal Anti-SULT2B1 Antibody
100 ul
$205.00
LY406066 Transient overexpression lysate of sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SULT2B1 or NM_177973"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204478
Predicted MW 41.3 kDa
Protein Sequence
Protein Sequence
>RC204478 protein sequence
Red=Cloning site Green=Tags(s)

MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPK
SGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKA
KVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITY
EELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGD
WKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPS
PSPGQASETPHPRPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_814444
RefSeq Size 1228
RefSeq ORF 1095
Synonyms ARCI14; HSST2
Locus ID 6820
UniProt ID O00204
Cytogenetics 19q13.33
Summary Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. provided by RefSeq, Jul 2008
Protein Pathways Androgen and estrogen metabolism, Sulfur metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SULT2B1" proteins (5)
SKU Description Size Price
LC406066 Lyophilized SULT2B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406066 Transient overexpression lysate of sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP304478 Recombinant protein of human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2, 20 µg 20 ug
$867.00
TP710313 Purified recombinant protein of Human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00
TP720859 Purified recombinant protein of Human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products