OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

L3HYPDH (NM_144581) Human Mass Spec Standard

Be the first to review this product
SKU
PH304205
C14orf149 MS Standard C13 and N15-labeled recombinant protein (NP_653182)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333517 Rabbit Polyclonal Anti-L3HYPDH Antibody
100 ul
$585.00
LY408289 Transient overexpression lysate of chromosome 14 open reading frame 149 (C14orf149) (as WB positive control) 100 ug
$436.00

Other products for "L3HYPDH or NM_144581"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204205
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC204205 protein sequence
Red=Cloning site Green=Tags(s)

MESALAVPWLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRRLMFEPR
GHRDMYGAVLVPSELPDAHLGVLFLHNEGYSSMCGHAVLALGRFALDFGLVPAPPAGTREARVNIHCPCG
LVTAFVACEDGRSHGPVRFHSVPAFVLATDLMVDVPGHGKVMVDIAYGGAFYAFVTAEKLGLDICSAKTR
DLVDAASAVTEAVKAQFKINHPDSEDLAFLYGTILTDGKDAYTKEPTTNICVFADEQVDRSPTGSGVTAR
IALQYHKGLLELNQMRAFKSSATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDPLRDG
FLLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653182
RefSeq Size 1381
RefSeq ORF 1062
Synonyms C14orf149
Locus ID 112849
UniProt ID Q96EM0
Cytogenetics 14q23.1
Summary The protein encoded by this gene is a dehydratase that converts trans-3-hydroxy-L-proline to delta(1)-pyrroline-2-carboxylate. This enzyme may function to degrade dietary proteins that contain trans-3-hydroxy-L-proline as well as other proteins such as collagen IV. The encoded protein can be converted to an epimerase by changing a threonine to a cysteine at a catalytic site. provided by RefSeq, Sep 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "L3HYPDH" proteins (3)
SKU Description Size Price
LC408289 Lyophilized L3HYPDH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408289 Transient overexpression lysate of chromosome 14 open reading frame 149 (C14orf149) (as WB positive control) 100 ug
$436.00
TP304205 Recombinant protein of human chromosome 14 open reading frame 149 (C14orf149), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products