OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SGK2 (NM_170693) Human Mass Spec Standard

Be the first to review this product
SKU
PH304101
SGK2 MS Standard C13 and N15-labeled recombinant protein (NP_733794)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA371168 SGK2 rabbit polyclonal antibody
100 ul
$310.00
LY414080 Transient overexpression lysate of serum/glucocorticoid regulated kinase 2 (SGK2), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "SGK2 or NM_170693"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204101
Predicted MW 41.2 kDa
Protein Sequence
Protein Sequence
>RC204101 protein sequence
Red=Cloning site Green=Tags(s)

MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKS
ILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYA
AEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEP
YDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSK
ADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASS
AFLGFSYAPEDDDILDC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_733794
RefSeq Size 1913
RefSeq ORF 1101
Synonyms dJ138B7.2; H-SGK2
Locus ID 10110
UniProt ID Q9HBY8
Cytogenetics 20q13.12
Summary This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants. provided by RefSeq, Nov 2010
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SGK2" proteins (5)
SKU Description Size Price
LC406797 Lyophilized SGK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414080 Lyophilized SGK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406797 Transient overexpression lysate of serum/glucocorticoid regulated kinase 2 (SGK2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY414080 Transient overexpression lysate of serum/glucocorticoid regulated kinase 2 (SGK2), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP304101 Recombinant protein of human serum/glucocorticoid regulated kinase 2 (SGK2), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products