IMP4 (NM_033416) Human Mass Spec Standard
CAT#: PH304015
IMP4 MS Standard C13 and N15-labeled recombinant protein (NP_219484)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204015 |
Predicted MW | 33.8 kDa |
Protein Sequence |
>RC204015 protein sequence
Red=Cloning site Green=Tags(s) MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTSH VDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHEVGALVRACKANGVTDLLVVH EHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSRLGKRVSDILRYLFPVP KDDSHRVITFANQDDYISFRHHVYKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTN TARKRVFLSTE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_219484 |
RefSeq Size | 1074 |
RefSeq ORF | 873 |
Synonyms | BXDC4 |
Locus ID | 92856 |
UniProt ID | Q96G21 |
Cytogenetics | 2q21.1 |
Summary | The protein encoded by this gene, along with IMP3 and MPP10, is part of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP) complex. This complex is necessary for the early cleavage steps of pre-18S ribosomal RNA processing. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409541 | IMP4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409541 | Transient overexpression lysate of IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4) |
USD 436.00 |
|
TP304015 | Recombinant protein of human IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4), 20 µg |
USD 867.00 |
|
TP761748 | Purified recombinant protein of Human IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4), full length, with N-terminal His tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review