OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IMP4 (NM_033416) Human Mass Spec Standard

Be the first to review this product
SKU
PH304015
IMP4 MS Standard C13 and N15-labeled recombinant protein (NP_219484)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358869 IMP4 Antibody - C-terminal region
100 ul
$585.00
LY409541 Transient overexpression lysate of IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4) (as WB positive control) 100 ug
$436.00

Other products for "IMP4 or NM_033416"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204015
Predicted MW 33.8 kDa
Protein Sequence
Protein Sequence
>RC204015 protein sequence
Red=Cloning site Green=Tags(s)

MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTSH
VDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHEVGALVRACKANGVTDLLVVH
EHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSRLGKRVSDILRYLFPVP
KDDSHRVITFANQDDYISFRHHVYKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTN
TARKRVFLSTE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_219484
RefSeq Size 1074
RefSeq ORF 873
Synonyms BXDC4
Locus ID 92856
UniProt ID Q96G21
Cytogenetics 2q21.1
Summary The protein encoded by this gene, along with IMP3 and MPP10, is part of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP) complex. This complex is necessary for the early cleavage steps of pre-18S ribosomal RNA processing. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Feb 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IMP4" proteins (4)
SKU Description Size Price
LC409541 Lyophilized IMP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409541 Transient overexpression lysate of IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4) (as WB positive control) 100 ug
$436.00
TP304015 Recombinant protein of human IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4), 20 µg 20 ug
$867.00
TP761748 Purified recombinant protein of Human IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast) (IMP4), full length, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products