IMP4 (NM_033416) Human Mass Spec Standard

CAT#: PH304015

IMP4 MS Standard C13 and N15-labeled recombinant protein (NP_219484)

Product Images

Coomassie blue staining of purified IMP4 protein (Cat# TP304015). The protein was produced from HEK293T cells transfected with IMP4 cDNA clone (Cat# RC204015) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204015
• Predicted MW: 33.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204015 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTSH
  VDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHEVGALVRACKANGVTDLLVVH
  EHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSRLGKRVSDILRYLFPVP
  KDDSHRVITFANQDDYISFRHHVYKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTN
  TARKRVFLSTE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_219484
• RefSeq Size: 1074
• RefSeq ORF: 873
• Synonyms: BXDC4
• Locus ID: 92856
• UniProt ID: Q96G21
• Cytogenetics: 2q21.1
• Summary: The protein encoded by this gene, along with IMP3 and MPP10, is part of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP) complex. This complex is necessary for the early cleavage steps of pre-18S ribosomal RNA processing. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]