OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WDR61 (NM_025234) Human Mass Spec Standard

Be the first to review this product
SKU
PH303963
WDR61 MS Standard C13 and N15-labeled recombinant protein (NP_079510)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA807590 WDR61 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10) 100 ul
$447.00
LY410745 Transient overexpression lysate of WD repeat domain 61 (WDR61) (as WB positive control) 100 ug
$436.00

Other products for "WDR61 or NM_025234"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203963
Predicted MW 33.6 kDa
Protein Sequence
Protein Sequence
>RC203963 protein sequence
Red=Cloning site Green=Tags(s)

MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSV
DISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKK
EYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASD
DGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGV
KYNGNGSKIVSVGDDQEIHIYDCPI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079510
RefSeq Size 1205
RefSeq ORF 915
Synonyms REC14; SKI8
Locus ID 80349
UniProt ID Q9GZS3
Cytogenetics 15q25.1
Summary WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance (Zhu et al., 2005 PubMed 16024656).supplied by OMIM, Mar 2008
Protein Pathways RNA degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WDR61" proteins (3)
SKU Description Size Price
LC410745 Lyophilized WDR61 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410745 Transient overexpression lysate of WD repeat domain 61 (WDR61) (as WB positive control) 100 ug
$436.00
TP303963 Recombinant protein of human WD repeat domain 61 (WDR61), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products