OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STMN4 (NM_030795) Human Mass Spec Standard

Be the first to review this product
SKU
PH303952
STMN4 MS Standard C13 and N15-labeled recombinant protein (NP_110422)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA315855 Rabbit polyclonal anti-STMN4 antibody
100 ul
$380.00
LY410717 Transient overexpression lysate of stathmin-like 4 (STMN4) (as WB positive control) 100 ug
$436.00

Other products for "STMN4 or NM_030795"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203952
Predicted MW 25.4 kDa
Protein Sequence
Protein Sequence
>RC203952 protein sequence
Red=Cloning site Green=Tags(s)

MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEGWCGRQCRRKDESQRKDSADWRERRAQADTVDLN
WCVISDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELL
KHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKEL
KEEASR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_110422
RefSeq Size 2352
RefSeq ORF 648
Synonyms RB3
Locus ID 81551
UniProt ID Q9H169
Cytogenetics 8p21.2
Summary Exhibits microtubule-destabilizing activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STMN4" proteins (3)
SKU Description Size Price
LC410717 Lyophilized STMN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410717 Transient overexpression lysate of stathmin-like 4 (STMN4) (as WB positive control) 100 ug
$436.00
TP303952 Recombinant protein of human stathmin-like 4 (STMN4), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products