OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Dynein (DYNLL2) (NM_080677) Human Mass Spec Standard

Be the first to review this product
SKU
PH303913
DYNLL2 MS Standard C13 and N15-labeled recombinant protein (NP_542408)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375671 DYNLL2 Rabbit polyclonal Antibody
100 ul
$410.00
LY409101 Transient overexpression lysate of dynein, light chain, LC8-type 2 (DYNLL2) (as WB positive control) 100 ug
$436.00

Other products for "Dynein or NM_080677"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203913
Predicted MW 10.3 kDa
Protein Sequence
Protein Sequence
>RC203913 protein sequence
Red=Cloning site Green=Tags(s)

MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET
KHFIYFYLGQVAILLFKSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542408
RefSeq Size 1522
RefSeq ORF 267
Synonyms Dlc2; DNCL1B; RSPH22
Locus ID 140735
UniProt ID Q96FJ2
Cytogenetics 17q22
Summary Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Dynein" proteins (3)
SKU Description Size Price
LC409101 Lyophilized DYNLL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409101 Transient overexpression lysate of dynein, light chain, LC8-type 2 (DYNLL2) (as WB positive control) 100 ug
$436.00
TP303913 Recombinant protein of human dynein, light chain, LC8-type 2 (DYNLL2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products