OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HEBP2 (NM_014320) Human Mass Spec Standard

Be the first to review this product
SKU
PH303899
HEBP2 MS Standard C13 and N15-labeled recombinant protein (NP_055135)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY402312 Transient overexpression lysate of heme binding protein 2 (HEBP2) (as WB positive control) 100 ug
$436.00

Other products for "HEBP2 or NM_014320"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203899
Predicted MW 22.9 kDa
Protein Sequence
Protein Sequence
>RC203899 protein sequence
Red=Cloning site Green=Tags(s)

MAEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVSTSVESMDWDSAIQTGFTKLN
SYIQGKNEKEMKIKMTAPVTSYVEPGSGPFSESTITISLYIPSEQQFDPPRPLESDVFIEDRAEMTVFVR
SFDGFSSAQKNQEQLLTLASILREDGKVFDEKVYYTAGYNSPVKLLNRNNEVWLIQKNEPTKENE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055135
RefSeq Size 1282
RefSeq ORF 615
Synonyms C6orf34; C6ORF34B; PP23; SOUL
Locus ID 23593
UniProt ID Q9Y5Z4
Cytogenetics 6q24.1
Summary The protein encoded by this gene is found predominately in the cytoplasm, where it plays a role in the collapse of mitochondrial membrane potential (MMP) prior to necrotic cell death. The encoded protein enhances outer and inner mitochondrial membrane permeabilization, especially under conditions of oxidative stress. provided by RefSeq, May 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HEBP2" proteins (3)
SKU Description Size Price
LC402312 Lyophilized HEBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402312 Transient overexpression lysate of heme binding protein 2 (HEBP2) (as WB positive control) 100 ug
$436.00
TP303899 Recombinant protein of human heme binding protein 2 (HEBP2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products