OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MOSC2 (MARC2) (NM_017898) Human Mass Spec Standard

Be the first to review this product
SKU
PH303877
MOSC2 MS Standard C13 and N15-labeled recombinant protein (NP_060368)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA330662 Rabbit Polyclonal Anti-MARC2 Antibody
100 ul
$585.00
LY413480 Transient overexpression lysate of MOCO sulphurase C-terminal domain containing 2 (MOSC2) (as WB positive control) 100 ug
$436.00

Other products for "MOSC2 or NM_017898"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203877
Predicted MW 38 kDa
Protein Sequence
Protein Sequence
>RC203877 protein sequence
Red=Cloning site Green=Tags(s)

MGASSSSALARLGLPARPWPRWLGVAALGLAAVALGTVAWRRAWPRRRRRLQQVGTVAKLWIYPVKSCKG
VPVSEAECTAMGLRSGNLRDRFWLVIKEDGHMVTARQEPRLVLISIIYENNCLIFRAPDMDQLVLPSKQP
SSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYC
PLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPD
TGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYYSVEKIGSLRVGDPVYRMV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060368
RefSeq Size 1618
RefSeq ORF 1005
Synonyms MARC2; MOSC2
Locus ID 54996
UniProt ID Q969Z3
Cytogenetics 1q41
Summary The protein encoded by this gene is an enzyme found in the outer mitochondrial membrane that reduces N-hydroxylated substrates. The encoded protein uses molybdenum as a cofactor and cytochrome b5 type B and NADH cytochrome b5 reductase as accessory proteins. One type of substrate used is N-hydroxylated nucleotide base analogues, which can be toxic to a cell. Other substrates include N(omega)-hydroxy-L-arginine (NOHA) and amidoxime prodrugs, which are activated by the encoded enzyme. Multiple transcript variants encoding the different isoforms have been found for this gene. provided by RefSeq, Sep 2016
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MOSC2" proteins (3)
SKU Description Size Price
LC413480 Lyophilized 42065 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413480 Transient overexpression lysate of MOCO sulphurase C-terminal domain containing 2 (MOSC2) (as WB positive control) 100 ug
$436.00
TP303877 Recombinant protein of human MOCO sulphurase C-terminal domain containing 2 (MOSC2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products