OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAT1A (NM_000429) Human Mass Spec Standard

Be the first to review this product
SKU
PH303765
MAT1A MS Standard C13 and N15-labeled recombinant protein (NP_000420)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346036 Rabbit Polyclonal Anti-MAT1A Antibody
100 ul
$525.00
LY400152 Transient overexpression lysate of methionine adenosyltransferase I, alpha (MAT1A) (as WB positive control) 100 ug
$436.00

Other products for "MAT1A or NM_000429"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203765
Predicted MW 43.6 kDa
Protein Sequence
Protein Sequence
>RC203765 protein sequence
Red=Cloning site Green=Tags(s)

MNGPVDGLCDHSLSEGVFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE
ITSMAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCVHLDRNEEDVGAGDQGLMFG
YATDETEECMPLTIILAHKLNARMADLRRSGLLPWLRPDSKTQVTVQYMQDNGAVIPVRIHTIVISVQHN
EDITLEEMRRALKEQVIRAVVPAKYLDEDTVYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGG
AFSGKDYTKVDRSAAYAARWVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH
KNFDLRPGVIVRDLDLKKPIYQKTACYGHFGRSEFPWEVPRKLVF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000420
RefSeq Size 3419
RefSeq ORF 1185
Synonyms MAT; MATA1; SAMS; SAMS1
Locus ID 4143
UniProt ID Q00266
Cytogenetics 10q22.3
Summary This gene catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. The encoded protein is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in this gene are associated with methionine adenosyltransferase deficiency. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAT1A" proteins (3)
SKU Description Size Price
LC400152 Lyophilized MAT1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400152 Transient overexpression lysate of methionine adenosyltransferase I, alpha (MAT1A) (as WB positive control) 100 ug
$436.00
TP303765 Recombinant protein of human methionine adenosyltransferase I, alpha (MAT1A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products