OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FKBP10 (NM_021939) Human Mass Spec Standard

Be the first to review this product
SKU
PH303676
FKBP10 MS Standard C13 and N15-labeled recombinant protein (NP_068758)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358846 FKBP10 Antibody - C-terminal region
100 ul
$585.00
LY411871 Transient overexpression lysate of FK506 binding protein 10, 65 kDa (FKBP10) (as WB positive control) 100 ug
$436.00

Other products for "FKBP10 or NM_021939"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203676
Predicted MW 64.2 kDa
Protein Sequence
Protein Sequence
>RC203676 protein sequence
Red=Cloning site Green=Tags(s)

MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQMGDFVRYHYN
GTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATL
YFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGTLLDGTSFDTSYSKGGTYDTYVGSGWL
IKGMDQGLLGMCPGERRKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLIDVHNPKDAVQLETLELPPGCV
RRAGAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYG
ENGTGDKIPGSAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLP
TGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDG
KITVDELKLKSDEDEERVHEEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068758
RefSeq Size 2888
RefSeq ORF 1746
Synonyms BRKS1; FKBP65; hFKBP65; OI6; OI11; PPIASE
Locus ID 60681
UniProt ID Q96AY3
Cytogenetics 17q21.2
Summary The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. This protein localizes to the endoplasmic reticulum and acts as a molecular chaperone. Alternatively spliced variants encoding different isoforms have been reported, but their biological validity has not been determined.provided by RefSeq, Nov 2009
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FKBP10" proteins (3)
SKU Description Size Price
LC411871 Lyophilized FKBP10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411871 Transient overexpression lysate of FK506 binding protein 10, 65 kDa (FKBP10) (as WB positive control) 100 ug
$436.00
TP303676 Recombinant protein of human FK506 binding protein 10, 65 kDa (FKBP10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products