OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDRG1 (NM_030815) Human Mass Spec Standard

Be the first to review this product
SKU
PH303661
PDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_110442)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504411 PDRG1 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12) 100 ul
$447.00
LY410685 Transient overexpression lysate of p53 and DNA-damage regulated 1 (PDRG1) (as WB positive control) 100 ug
$436.00

Other products for "PDRG1 or NM_030815"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203661
Predicted MW 15.5 kDa
Protein Sequence
Protein Sequence
>RC203661 protein sequence
Red=Cloning site Green=Tags(s)

MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPH
PETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_110442
RefSeq Size 1384
RefSeq ORF 399
Synonyms C20orf126; PDRG
Locus ID 81572
UniProt ID Q9NUG6
Cytogenetics 20q11.21
Summary May play a role in chaperone-mediated protein folding.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDRG1" proteins (3)
SKU Description Size Price
LC410685 Lyophilized PDRG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410685 Transient overexpression lysate of p53 and DNA-damage regulated 1 (PDRG1) (as WB positive control) 100 ug
$436.00
TP303661 Recombinant protein of human p53 and DNA damage regulated 1 (PDRG1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products