OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

R3HDM4 (NM_138774) Human Mass Spec Standard

Be the first to review this product
SKU
PH303619
C19orf22 MS Standard C13 and N15-labeled recombinant protein (NP_620129)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333534 Rabbit Polyclonal Anti-R3HDM4 Antibody
100 ul
$585.00
LY408514 Transient overexpression lysate of chromosome 19 open reading frame 22 (C19orf22) (as WB positive control) 100 ug
$436.00

Other products for "R3HDM4 or NM_138774"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203619
Predicted MW 30.2 kDa
Protein Sequence
Protein Sequence
>RC203619 representing NM_138774
Red=Cloning site Green=Tags(s)

MVALENPECGPEAAEGTPGGRRLLPLPSCLPALASSQVKRLSASRRKQHFINQAVRNSDLVPKAKGRKSL
QRLENTQYLLTLLETDGGLPGLEDGDLAPPASPGIFAEACNNATYVEVWNDFMNRSGEEQERVLRYLEDE
GRSKARRRGPGRGEDRRREDPAYTPRECFQRISRRLRAVLKRSRIPMETLETWEERLLRFFSVSPQAVYT
AMLDNSFERLLLHAVCQYMDLISASADLEGKRQMKVSNRHLDFLPPGLLLSAYLEQHS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620129
RefSeq Size 1810
RefSeq ORF 804
Synonyms C19orf22
Locus ID 91300
UniProt ID Q96D70
Cytogenetics 19p13.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "R3HDM4" proteins (3)
SKU Description Size Price
LC408514 Lyophilized R3HDM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408514 Transient overexpression lysate of chromosome 19 open reading frame 22 (C19orf22) (as WB positive control) 100 ug
$436.00
TP303619 Recombinant protein of human chromosome 19 open reading frame 22 (C19orf22), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products