OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VILIP3 (HPCAL1) (NM_002149) Human Mass Spec Standard

Be the first to review this product
SKU
PH303570
HPCAL1 MS Standard C13 and N15-labeled recombinant protein (NP_002140)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366402 HPCAL1 rabbit polyclonal antibody
100 ul
$310.00
LY408747 Transient overexpression lysate of hippocalcin-like 1 (HPCAL1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "VILIP3 or NM_002149"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203570
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC203570 protein sequence
Red=Cloning site Green=Tags(s)

MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFR
TFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPE
DESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002140
RefSeq Size 1779
RefSeq ORF 579
Synonyms BDR1; HLP2; VILIP-3
Locus ID 3241
UniProt ID P37235
Cytogenetics 2p25.1
Summary The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. It is highly similar to human hippocalcin protein and nearly identical to the rat and mouse hippocalcin like-1 proteins. It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation and may be of relevance for neuronal signalling in the central nervous system. Several alternatively spliced transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Apr 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VILIP3" proteins (8)
SKU Description Size Price
PH303476 HPCAL1 MS Standard C13 and N15-labeled recombinant protein (NP_602293) 10 ug
$3,360.00
LC408747 Lyophilized HPCAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419502 Lyophilized HPCAL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408747 Transient overexpression lysate of hippocalcin-like 1 (HPCAL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419502 Transient overexpression lysate of hippocalcin-like 1 (HPCAL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303476 Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 2, 20 µg 20 ug
$867.00
TP303570 Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 1, 20 µg 20 ug
$867.00
TP720206 Recombinant protein of human hippocalcin-like 1 (HPCAL1), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products