OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KLHDC3 (NM_057161) Human Mass Spec Standard

Be the first to review this product
SKU
PH303552
KLHDC3 MS Standard C13 and N15-labeled recombinant protein (NP_476502)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA340233 Rabbit Polyclonal Anti-KLHDC3 Antibody
100 ul
$585.00
LY409263 Transient overexpression lysate of kelch domain containing 3 (KLHDC3) (as WB positive control) 100 ug
$436.00

Other products for "KLHDC3 or NM_057161"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203552
Predicted MW 43.1 kDa
Protein Sequence
Protein Sequence
>RC203552 protein sequence
Red=Cloning site Green=Tags(s)

MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQA
PVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIM
YIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNE
IYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKK
IEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYN
LDQSCLPHDIRWELNAMTTNSNISRPIVSSHG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_476502
RefSeq Size 2029
RefSeq ORF 1146
Synonyms dJ20C7.3; PEAS
Locus ID 116138
UniProt ID Q9BQ90
Cytogenetics 6p21.1
Summary The protein encoded by this gene contains six repeated kelch motifs that are structurally similar to recombination activating gene 2, a protein involved in the activation of the V(D)J recombination. In mouse, this gene is found to be expressed specifically in testis. Its expression in pachytene spermatocytes is localized to cytoplasma and meiotic chromatin, suggesting that this gene may be involved in meiotic recombination. provided by RefSeq, Jun 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KLHDC3" proteins (3)
SKU Description Size Price
LC409263 Lyophilized KLHDC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409263 Transient overexpression lysate of kelch domain containing 3 (KLHDC3) (as WB positive control) 100 ug
$436.00
TP303552 Recombinant protein of human kelch domain containing 3 (KLHDC3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products