OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARPM1 (ACTRT3) (NM_032487) Human Mass Spec Standard

Be the first to review this product
SKU
PH303548
ARPM1 MS Standard C13 and N15-labeled recombinant protein (NP_115876)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342881 Rabbit Polyclonal Anti-ACTRT3 Antibody
100 ul
$585.00
LY410114 Transient overexpression lysate of actin related protein M1 (ARPM1) (as WB positive control) 100 ug
$436.00

Other products for "ARPM1 or NM_032487"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203548
Predicted MW 40.9 kDa
Protein Sequence
Protein Sequence
>RC203548 protein sequence
Red=Cloning site Green=Tags(s)

MNHCQLPVVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPV
ERGLITSCEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLA
LFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIMLLSASDRKIVED
IKESFCYVAMNYEEEMAKKPDCLEKVYQLPDGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSSIM
KCDTGLRNSFFSNIILAGGSTSFPGLDKRLVKDIAKVAPANTAVQVIAPPERKISVWMGGSILASLSAFQ
DMWITAAEFKEVGPNIVHQRCF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115876
RefSeq Size 2017
RefSeq ORF 1116
Synonyms ARP-T3; ARPM1
Locus ID 84517
UniProt ID Q9BYD9
Cytogenetics 3q26.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARPM1" proteins (3)
SKU Description Size Price
LC410114 Lyophilized ACTRT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410114 Transient overexpression lysate of actin related protein M1 (ARPM1) (as WB positive control) 100 ug
$436.00
TP303548 Recombinant protein of human actin related protein M1 (ARPM1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products