OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPP25 (NM_017793) Human Mass Spec Standard

Be the first to review this product
SKU
PH303538
RPP25 MS Standard C13 and N15-labeled recombinant protein (NP_060263)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA381080 RPP25 Rabbit polyclonal Antibody
100 ul
$410.00
LY413534 Transient overexpression lysate of ribonuclease P/MRP 25kDa subunit (RPP25) (as WB positive control) 100 ug
$436.00

Other products for "RPP25 or NM_017793"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203538
Predicted MW 20.6 kDa
Protein Sequence
Protein Sequence
>RC203538 protein sequence
Red=Cloning site Green=Tags(s)

MENFRKVRSEEAPAGCGAEGGGPGSGPFADLAPGAVHMRVKEGSKIRNLMAFATASMAQPATRAIVFSGC
GRATTKTVTCAEILKRRLAGLHQVTRLRYRSVREVWQSLPPGPTQGQTPGEPAASLSVLKNVPGLAILLS
KDALDPRQPGYQPPNPHPGPSSPPAAPASKRSLGEPAAGEGSAKRSQPEPGVADEDQTA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060263
RefSeq Size 2333
RefSeq ORF 597
Locus ID 54913
UniProt ID Q9BUL9
Cytogenetics 15q24.2
Summary Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends (PubMed:12003489, PubMed:16723659, PubMed:30454648). Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences (PubMed:28115465).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RPP25" proteins (3)
SKU Description Size Price
LC413534 Lyophilized RPP25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413534 Transient overexpression lysate of ribonuclease P/MRP 25kDa subunit (RPP25) (as WB positive control) 100 ug
$436.00
TP303538 Recombinant protein of human ribonuclease P/MRP 25kDa subunit (RPP25), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products