CDC34 (NM_004359) Human Mass Spec Standard

SKU
PH303517
CDC34 MS Standard C13 and N15-labeled recombinant protein (NP_004350)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203517]
Predicted MW 26.6 kDa
Protein Sequence
Protein Sequence
>RC203517 representing NM_004359
Red=Cloning site Green=Tags(s)

MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPY
SPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA
NVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDY
YEDGEVEEEADSCFGDDEDDSGTEES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004350
RefSeq Size 1462
RefSeq ORF 708
Synonyms E2-CDC34; UBC3; UBCH3; UBE2R1
Locus ID 997
UniProt ID P49427
Cytogenetics 19p13.3
Summary The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication. [provided by RefSeq, Jul 2008]
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:CDC34 (NM_004359) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418044 CDC34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418044 Transient overexpression lysate of cell division cycle 34 homolog (S. cerevisiae) (CDC34) 100 ug
$436.00
TP303517 Recombinant protein of human cell division cycle 34 homolog (S. cerevisiae) (CDC34), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.