OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDC34 (NM_004359) Human Mass Spec Standard

Be the first to review this product
SKU
PH303517
CDC34 MS Standard C13 and N15-labeled recombinant protein (NP_004350)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351064 Rabbit Polyclonal Anti-CDC34 Antibody
100 ul
$205.00
LY418044 Transient overexpression lysate of cell division cycle 34 homolog (S. cerevisiae) (CDC34) (as WB positive control) 100 ug
$436.00

Other products for "CDC34 or NM_004359"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203517
Predicted MW 26.6 kDa
Protein Sequence
Protein Sequence
>RC203517 representing NM_004359
Red=Cloning site Green=Tags(s)

MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPY
SPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA
NVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDY
YEDGEVEEEADSCFGDDEDDSGTEES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004350
RefSeq Size 1462
RefSeq ORF 708
Synonyms E2-CDC34; UBC3; UBCH3; UBE2R1
Locus ID 997
UniProt ID P49427
Cytogenetics 19p13.3
Summary The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication. provided by RefSeq, Jul 2008
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDC34" proteins (3)
SKU Description Size Price
LC418044 Lyophilized CDC34 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418044 Transient overexpression lysate of cell division cycle 34 homolog (S. cerevisiae) (CDC34) (as WB positive control) 100 ug
$436.00
TP303517 Recombinant protein of human cell division cycle 34 homolog (S. cerevisiae) (CDC34), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products