OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Phosphatidic acid phosphatase type 2B (PLPP3) (NM_003713) Human Mass Spec Standard

Be the first to review this product
SKU
PH303480
PPAP2B MS Standard C13 and N15-labeled recombinant protein (NP_003704)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA380190 PPAP2B Rabbit polyclonal Antibody
100 ul
$410.00
LY406156 Transient overexpression lysate of phosphatidic acid phosphatase type 2B (PPAP2B), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "Phosphatidic acid phosphatase type 2B or NM_003713"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203480
Predicted MW 35.1 kDa
Protein Sequence
Protein Sequence
>RC203480 protein sequence
Red=Cloning site Green=Tags(s)

MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCND
ESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAIS
QSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYL
VLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKT
KMTLSLPAPAIRKEILSPVDIIDRNNHHNMM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003704
RefSeq Size 3324
RefSeq ORF 933
Synonyms Dri42; LPP3; PAP2B; PPAP2B; VCIP
Locus ID 8613
UniProt ID O14495
Cytogenetics 1p32.2
Summary The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. provided by RefSeq, Mar 2010
Protein Families Druggable Genome, Transmembrane
Protein Pathways Ether lipid metabolism, Fc gamma R-mediated phagocytosis, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Sphingolipid metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Phosphatidic acid phosphatase type 2B" proteins (3)
SKU Description Size Price
LC418485 Lyophilized PPAP2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418485 Transient overexpression lysate of phosphatidic acid phosphatase type 2B (PPAP2B), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303480 Recombinant protein of human phosphatidic acid phosphatase type 2B (PPAP2B), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products