OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM176A (NM_018487) Human Mass Spec Standard

Be the first to review this product
SKU
PH303433
TMEM176A MS Standard C13 and N15-labeled recombinant protein (NP_060957)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331855 Rabbit Polyclonal Anti-TMEM176A Antibody
100 ul
$585.00
LY413014 Transient overexpression lysate of transmembrane protein 176A (TMEM176A) (as WB positive control) 100 ug
$436.00

Other products for "TMEM176A or NM_018487"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203433
Predicted MW 26.1 kDa
Protein Sequence
Protein Sequence
>RC203433 protein sequence
Red=Cloning site Green=Tags(s)

MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLTCCSALRPRATQARGSSRLLVASWVMQIVLGILSAV
LGGFFYIRDYTLLVTSGAAIWTGAVAVLAGAAAFIYEKRGGTYWALLRTLLTLAAFSTAIAALKLWNEDF
RYGYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQAMLLGVWILLLLASLTPL
WLYCWRMFPTKGKRDQKEMLEVSGI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060957
RefSeq Size 1047
RefSeq ORF 705
Synonyms GS188; HCA112; MS4B1
Locus ID 55365
UniProt ID Q96HP8
Cytogenetics 7q36.1
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM176A" proteins (3)
SKU Description Size Price
LC413014 Lyophilized TMEM176A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413014 Transient overexpression lysate of transmembrane protein 176A (TMEM176A) (as WB positive control) 100 ug
$436.00
TP303433 Recombinant protein of human transmembrane protein 176A (TMEM176A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products