OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCUN1D1 (NM_020640) Human Mass Spec Standard

Be the first to review this product
SKU
PH303427
DCUN1D1 MS Standard C13 and N15-labeled recombinant protein (NP_065691)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA311491 Goat Anti-DCUN1D1 Antibody
100 ug
$565.00
LY402796 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (DCUN1D1) (as WB positive control) 100 ug
$436.00

Other products for "DCUN1D1 or NM_020640"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203427
Predicted MW 30.1 kDa
Protein Sequence
Protein Sequence
>RC203427 protein sequence
Red=Cloning site Green=Tags(s)

MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN
RYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQ
IPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPK
DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065691
RefSeq Size 3192
RefSeq ORF 777
Synonyms DCNL1; DCUN1L1; RP42; SCCRO; SCRO; Tes3
Locus ID 54165
UniProt ID Q96GG9
Cytogenetics 3q26.33
Summary Part of an E3 ubiquitin ligase complex for neddylation. Promotes neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes. Acts by binding to cullin-RBX1 complexes in the cytoplasm and promoting their nuclear translocation, enhancing recruitment of E2-NEDD8 (UBE2M-NEDD8) thioester to the complex, and optimizing the orientation of proteins in the complex to allow efficient transfer of NEDD8 from the E2 to the cullin substrates. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity (PubMed:25349211, PubMed:28581483). Acts also as an oncogene facilitating malignant transformation and carcinogenic progression (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCUN1D1" proteins (4)
SKU Description Size Price
LC402796 Lyophilized DCUN1D1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402796 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (DCUN1D1) (as WB positive control) 100 ug
$436.00
TP303427 Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (DCUN1D1), 20 µg 20 ug
$737.00
TP720243 Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (DCUN1D1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products