OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RDH14 (NM_020905) Human Mass Spec Standard

Be the first to review this product
SKU
PH303411
RDH14 MS Standard C13 and N15-labeled recombinant protein (NP_065956)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502478 RDH14 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7) 100 ul
$447.00
LY412210 Transient overexpression lysate of retinol dehydrogenase 14 (all-trans/9-cis/11-cis) (RDH14) (as WB positive control) 100 ug
$436.00

Other products for "RDH14 or NM_020905"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203411
Predicted MW 36.9 kDa
Protein Sequence
Protein Sequence
>RC203411 protein sequence
Red=Cloning site Green=Tags(s)

MAVATAAAVLAALGGALWLAARRFVGPRVQRLRRGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARV
IMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLI
NNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSEQS
YNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPV
EGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGLLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065956
RefSeq Size 1602
RefSeq ORF 1008
Synonyms PAN2; SDR7C4
Locus ID 57665
UniProt ID Q9HBH5
Cytogenetics 2p24.2
Summary Retinol dehydrogenase with a clear preference for NADP. Displays high activity towards 9-cis, 11-cis and all-trans-retinol. Shows a very weak activity towards 13-cis-retinol. Has no activity towards steroid.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RDH14" proteins (3)
SKU Description Size Price
LC412210 Lyophilized RDH14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412210 Transient overexpression lysate of retinol dehydrogenase 14 (all-trans/9-cis/11-cis) (RDH14) (as WB positive control) 100 ug
$436.00
TP303411 Recombinant protein of human retinol dehydrogenase 14 (all-trans/9-cis/11-cis) (RDH14), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products