OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHODL (NM_024944) Human Mass Spec Standard

Be the first to review this product
SKU
PH303392
CHODL MS Standard C13 and N15-labeled recombinant protein (NP_079220)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA372234 CHODL rabbit polyclonal antibody
100 ul
$310.00
LY403046 Transient overexpression lysate of chondrolectin (CHODL) (as WB positive control) 100 ug
$436.00

Other products for "CHODL or NM_024944"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203392
Predicted MW 30.4 kDa
Protein Sequence
Protein Sequence
>RC203392 protein sequence
Red=Cloning site Green=Tags(s)

MSRVVSLLLGAALLCGHGAFCRRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLS
LENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCG
SEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTE
AGIIPNLIYVVIPTIPLLLLILVAFGTCCFQMLHKSKGRTKTSPNQSTLWISKSTRKESGMEV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079220
RefSeq Size 2625
RefSeq ORF 819
Synonyms C21orf68; MT75; PRED12
Locus ID 140578
UniProt ID Q9H9P2
Cytogenetics 21q21.1
Summary This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. Several transcript variants encoding a few different isoforms have been found for this gene. provided by RefSeq, Feb 2011
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CHODL" proteins (3)
SKU Description Size Price
LC403046 Lyophilized CHODL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403046 Transient overexpression lysate of chondrolectin (CHODL) (as WB positive control) 100 ug
$436.00
TP303392 Recombinant protein of human chondrolectin (CHODL), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products