OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RTL10 (NM_024627) Human Mass Spec Standard

Be the first to review this product
SKU
PH303371
C22orf29 MS Standard C13 and N15-labeled recombinant protein (NP_078903)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411106 Transient overexpression lysate of chromosome 22 open reading frame 29 (C22orf29) (as WB positive control) 100 ug
$436.00

Other products for "RTL10 or NM_024627"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203371
Predicted MW 39.3 kDa
Protein Sequence
Protein Sequence
>RC203371 protein sequence
Red=Cloning site Green=Tags(s)

MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRTTMEQKSTASG
TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVC
EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCPLPLASSQLPVAPQLP
VVRQYLARFLEGLALDMGTAPRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSS
KPGPVEPASSQPEEAAPTPVPRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVE
APETPGEPPLSPGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078903
RefSeq Size 6693
RefSeq ORF 1092
Synonyms BOP; C22orf29
Locus ID 79680
UniProt ID Q7L3V2
Cytogenetics 22q11.21
Summary Could induce apoptosis in a BH3 domain-dependent manner. The direct interaction network of Bcl-2 family members may play a key role in modulation RTL10/BOP intrinsic apoptotic signaling activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RTL10" proteins (3)
SKU Description Size Price
LC411106 Lyophilized C22orf29 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411106 Transient overexpression lysate of chromosome 22 open reading frame 29 (C22orf29) (as WB positive control) 100 ug
$436.00
TP303371 Recombinant protein of human chromosome 22 open reading frame 29 (C22orf29), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products