OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C2orf43 (LDAH) (NM_021925) Human Mass Spec Standard

Be the first to review this product
SKU
PH303367
C2orf43 MS Standard C13 and N15-labeled recombinant protein (NP_068744)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504833 C2orf43 mouse monoclonal antibody, clone OTI2G9 (formerly 2G9) 100 ul
$447.00
LY411891 Transient overexpression lysate of chromosome 2 open reading frame 43 (C2orf43) (as WB positive control) 100 ug
$436.00

Other products for "C2orf43 or NM_021925"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203367
Predicted MW 37.3 kDa
Protein Sequence
Protein Sequence
>RC203367 protein sequence
Red=Cloning site Green=Tags(s)

MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSL
TNRRFPVWTISHAGHALAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSI
GSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLI
RRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYE
DIKKDFPEGDIRLCEKNIPHAFITHFNQEMADMIADSLKDDLSKM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068744
RefSeq Size 3963
RefSeq ORF 975
Synonyms C2orf43; hLDAH
Locus ID 60526
UniProt ID Q9H6V9
Cytogenetics 2p24.1
Summary Serine lipid hydrolase associated with lipid droplets. Highly expressed in macrophage-rich areas in atherosclerotic lesions, suggesting that it could promote cholesterol ester turnover in macrophages.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C2orf43" proteins (3)
SKU Description Size Price
LC411891 Lyophilized LDAH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411891 Transient overexpression lysate of chromosome 2 open reading frame 43 (C2orf43) (as WB positive control) 100 ug
$436.00
TP303367 Recombinant protein of human chromosome 2 open reading frame 43 (C2orf43), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products