OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HINT1 (NM_005340) Human Mass Spec Standard

Be the first to review this product
SKU
PH303319
HINT1 MS Standard C13 and N15-labeled recombinant protein (NP_005331)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351246 Rabbit Polyclonal Anti-HINT1 Antibody
100 ul
$205.00
LY417372 Transient overexpression lysate of histidine triad nucleotide binding protein 1 (HINT1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "HINT1 or NM_005340"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203319
Predicted MW 13.8 kDa
Protein Sequence
Protein Sequence
>RC203319 protein sequence
Red=Cloning site Green=Tags(s)

MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDD
ESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005331
RefSeq Size 689
RefSeq ORF 378
Synonyms HINT; NMAN; PKCI-1; PRKCNH1
Locus ID 3094
UniProt ID P49773
Cytogenetics 5q23.3
Summary This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. provided by RefSeq, Dec 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HINT1" proteins (3)
SKU Description Size Price
LC417372 Lyophilized HINT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417372 Transient overexpression lysate of histidine triad nucleotide binding protein 1 (HINT1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP303319 Recombinant protein of human histidine triad nucleotide binding protein 1 (HINT1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products