OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SIAH Interacting Protein (CACYBP) (NM_014412) Human Mass Spec Standard

Be the first to review this product
SKU
PH303302
CACYBP MS Standard C13 and N15-labeled recombinant protein (NP_055227)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308595 Rabbit Polyclonal antibody to CacyBP (calcyclin binding protein)
100 ul
$665.00
LY415305 Transient overexpression lysate of calcyclin binding protein (CACYBP), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SIAH Interacting Protein or NM_014412"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203302
Predicted MW 26.2 kDa
Protein Sequence
Protein Sequence
>RC203302 protein sequence
Red=Cloning site Green=Tags(s)

MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITTG
YTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEG
SSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTI
NKAWVESREKQAKGDTEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055227
RefSeq Size 3060
RefSeq ORF 684
Synonyms GIG5; PNAS-107; S100A6BP; SIP
Locus ID 27101
UniProt ID Q9HB71
Cytogenetics 1q25.1
Summary The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Pathways Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SIAH Interacting Protein" proteins (7)
SKU Description Size Price
PH309815 CACYBP MS Standard C13 and N15-labeled recombinant protein (NP_001007215) 10 ug
$3,360.00
LC415305 Lyophilized CACYBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423448 Lyophilized CACYBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415305 Transient overexpression lysate of calcyclin binding protein (CACYBP), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423448 Transient overexpression lysate of calcyclin binding protein (CACYBP), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303302 Recombinant protein of human calcyclin binding protein (CACYBP), transcript variant 1, 20 µg 20 ug
$867.00
TP309815 Recombinant protein of human calcyclin binding protein (CACYBP), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products