OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MT1H (NM_005951) Human Mass Spec Standard

Be the first to review this product
SKU
PH303257
MT1H MS Standard C13 and N15-labeled recombinant protein (NP_005942)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401801 Transient overexpression lysate of metallothionein 1H (MT1H) (as WB positive control) 100 ug
$436.00

Other products for "MT1H or NM_005951"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203257
Predicted MW 6 kDa
Protein Sequence
Protein Sequence
>RC203257 protein sequence
Red=Cloning site Green=Tags(s)

MDPNCSCEAGGSCACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCICKGASEKCSCCA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005942
RefSeq Size 397
RefSeq ORF 183
Synonyms MT-0; MT-1H; MT-IH; MT1
Locus ID 4496
UniProt ID P80294
Cytogenetics 16q13
Summary Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MT1H" proteins (3)
SKU Description Size Price
LC401801 Lyophilized MT1H HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401801 Transient overexpression lysate of metallothionein 1H (MT1H) (as WB positive control) 100 ug
$436.00
TP303257 Recombinant protein of human metallothionein 1H (MT1H), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products