OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZC3HAV1L (NM_080660) Human Mass Spec Standard

Be the first to review this product
SKU
PH303208
ZC3HAV1L MS Standard C13 and N15-labeled recombinant protein (NP_542391)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408964 Transient overexpression lysate of zinc finger CCCH-type, antiviral 1-like (ZC3HAV1L) (as WB positive control) 100 ug
$436.00

Other products for "ZC3HAV1L or NM_080660"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203208
Predicted MW 32.8 kDa
Protein Sequence
Protein Sequence
>RC203208 representing NM_080660
Red=Cloning site Green=Tags(s)

MAEPTVCSFLTKVLCAHGGRMFLKDLRGHVELSEARLRDVLQRAGPERFLLQEVETQEGLGDAEAEAAAG
AVGGGGTSAWRVVAVSSVRLCARYQRGECQACDQLHFCRRHMLGKCPNRDCWSTCTLSHDIHTPVNMQVL
KSHGLFGLNENQLRILLLQNDPCLLPEVCLLYNKGEALYGYCNLKDKCNKFHVCKSFVKGECKLQTCKRS
HQLIHAASLKLLQDQGLNIPSVVNFQIISTYKHIKLHKMLENTDNSSPSTEHSQGLEKQGVHAAGAAEAG
PLASVPAQSAKKPCPVSCEK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542391
RefSeq Size 1802
RefSeq ORF 900
Synonyms C7orf39
Locus ID 92092
UniProt ID Q96H79
Cytogenetics 7q34
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZC3HAV1L" proteins (3)
SKU Description Size Price
LC408964 Lyophilized ZC3HAV1L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408964 Transient overexpression lysate of zinc finger CCCH-type, antiviral 1-like (ZC3HAV1L) (as WB positive control) 100 ug
$436.00
TP303208 Recombinant protein of human zinc finger CCCH-type, antiviral 1-like (ZC3HAV1L), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products