OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AKR1B10 (NM_020299) Human Mass Spec Standard

Be the first to review this product
SKU
PH303177
AKR1B10 MS Standard C13 and N15-labeled recombinant protein (NP_064695)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308188 Rabbit polyclonal antibody to AKR1B10 (aldo-keto reductase family 1, member B10 (aldose reductase))
100 ul
$665.00
LY402772 Transient overexpression lysate of aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10) (as WB positive control) 100 ug
$436.00

Other products for "AKR1B10 or NM_020299"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203177
Predicted MW 36 kDa
Protein Sequence
Protein Sequence
>RC203177 protein sequence
Red=Cloning site Green=Tags(s)

MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKR
EDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLD
AWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAY
SPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK
LSDEEMATILSFNRNWRACNVLQSSHLEDYPFDAEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064695
RefSeq Size 1610
RefSeq ORF 948
Synonyms AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI
Locus ID 57016
UniProt ID O60218
Cytogenetics 7q33
Summary This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Butanoate metabolism, Fructose and mannose metabolism, Linoleic acid metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AKR1B10" proteins (3)
SKU Description Size Price
LC402772 Lyophilized AKR1B10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402772 Transient overexpression lysate of aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10) (as WB positive control) 100 ug
$436.00
TP303177 Recombinant protein of human aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products