OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NAT8 (NM_003960) Human Mass Spec Standard

Be the first to review this product
SKU
PH303157
NAT8 MS Standard C13 and N15-labeled recombinant protein (NP_003951)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500544 Anti-NAT8 mouse monoclonal antibody, clone OTI5A8 (formerly 5A8) 100 ul
$447.00
LY401303 Transient overexpression lysate of N-acetyltransferase 8 (GCN5-related, putative) (NAT8) (as WB positive control) 100 ug
$436.00

Other products for "NAT8 or NM_003960"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203157
Predicted MW 25.6 kDa
Protein Sequence
Protein Sequence
>RC203157 protein sequence
Red=Cloning site Green=Tags(s)

MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISL
FPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLF
HLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVAL
HTVHFIYHLPSSKVGSQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003951
RefSeq Size 1073
RefSeq ORF 681
Synonyms ATase2; CCNAT; CML1; GLA; Hcml1; TSC501; TSC510
Locus ID 9027
UniProt ID Q9UHE5
Cytogenetics 2p13.1
Summary This gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene. provided by RefSeq, Sep 2008
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NAT8" proteins (3)
SKU Description Size Price
LC401303 Lyophilized NAT8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401303 Transient overexpression lysate of N-acetyltransferase 8 (GCN5-related, putative) (NAT8) (as WB positive control) 100 ug
$436.00
TP303157 Recombinant protein of human N-acetyltransferase 8 (GCN5-related, putative) (NAT8), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products