OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PI3 (NM_002638) Human Mass Spec Standard

Be the first to review this product
SKU
PH303136
PI3 MS Standard C13 and N15-labeled recombinant protein (NP_002629)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA356507 PI3 Antibody - N-terminal region
100 ul
$585.00
LY400936 Transient overexpression lysate of peptidase inhibitor 3, skin-derived (PI3) (as WB positive control) 100 ug
$436.00

Other products for "PI3 or NM_002638"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203136
Predicted MW 12.3 kDa
Protein Sequence
Protein Sequence
>RC203136 protein sequence
Red=Cloning site Green=Tags(s)

MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVS
TKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002629
RefSeq Size 579
RefSeq ORF 351
Synonyms cementoin; ESI; SKALP; WAP3; WFDC14
Locus ID 5266
UniProt ID P19957
Cytogenetics 20q13.12
Summary This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. provided by RefSeq, Oct 2014
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PI3" proteins (4)
SKU Description Size Price
LC400936 Lyophilized PI3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400936 Transient overexpression lysate of peptidase inhibitor 3, skin-derived (PI3) (as WB positive control) 100 ug
$436.00
TP303136 Recombinant protein of human peptidase inhibitor 3, skin-derived (PI3), 20 µg 20 ug
$867.00
TP720751 Purified recombinant protein of Human peptidase inhibitor 3, skin-derived (PI3) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products