OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tetranectin (CLEC3B) (NM_003278) Human Mass Spec Standard

Be the first to review this product
SKU
PH303128
CLEC3B MS Standard C13 and N15-labeled recombinant protein (NP_003269)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA384015 Tetranectin Rabbit monoclonal Antibody
100 ul
$380.00
LY418793 Transient overexpression lysate of C-type lectin domain family 3, member B (CLEC3B) (as WB positive control) 100 ug
$436.00

Other products for "Tetranectin or NM_003278"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203128
Predicted MW 22.6 kDa
Protein Sequence
Protein Sequence
>RC203128 protein sequence
Red=Cloning site Green=Tags(s)

MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTV
CLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAA
EGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003269
RefSeq Size 886
RefSeq ORF 606
Synonyms TN; TNA
Locus ID 7123
UniProt ID P05452
Cytogenetics 3p21.31
Summary Tetranectin binds to plasminogen and to isolated kringle 4. May be involved in the packaging of molecules destined for exocytosis.UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Tetranectin" proteins (4)
SKU Description Size Price
LC418793 Lyophilized CLEC3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418793 Transient overexpression lysate of C-type lectin domain family 3, member B (CLEC3B) (as WB positive control) 100 ug
$436.00
TP303128 Recombinant protein of human C-type lectin domain family 3, member B (CLEC3B), 20 µg 20 ug
$867.00
TP720380 Recombinant protein of human C-type lectin domain family 3, member B (CLEC3B) 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products