Cystatin A (CSTA) (NM_005213) Human Mass Spec Standard

CAT#: PH303115

CSTA MS Standard C13 and N15-labeled recombinant protein (NP_005204)

Product Images

Coomassie blue staining of purified CSTA protein (Cat# TP303115). The protein was produced from HEK293T cells transfected with CSTA cDNA clone (Cat# RC203115) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203115
• Predicted MW: 11 kDa
• Protein Sequence:
  Sequence Link

  >RC203115 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVF
  KSLPGQNEDLVLTGYQVDKNKDDELTGF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005204
• RefSeq Size: 838
• RefSeq ORF: 294
• Synonyms: AREI; PSS4; STF1; STFA
• Locus ID: 1475
• UniProt ID: P01040
• Cytogenetics: 3q21.1
• Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. [provided by RefSeq, Jul 2008]