OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cystatin A (CSTA) (NM_005213) Human Mass Spec Standard

Be the first to review this product
SKU
PH303115
CSTA MS Standard C13 and N15-labeled recombinant protein (NP_005204)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA313707 Rabbit polyclonal anti-Stefin A antibody
100 ul
$380.00
LY401596 Transient overexpression lysate of cystatin A (stefin A) (CSTA) (as WB positive control) 100 ug
$436.00

Other products for "Cystatin A or NM_005213"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203115
Predicted MW 11 kDa
Protein Sequence
Protein Sequence
>RC203115 protein sequence
Red=Cloning site Green=Tags(s)

MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVF
KSLPGQNEDLVLTGYQVDKNKDDELTGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005204
RefSeq Size 838
RefSeq ORF 294
Synonyms AREI; PSS4; STF1; STFA
Locus ID 1475
UniProt ID P01040
Cytogenetics 3q21.1
Summary The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Cystatin A" proteins (4)
SKU Description Size Price
LC401596 Lyophilized CSTA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401596 Transient overexpression lysate of cystatin A (stefin A) (CSTA) (as WB positive control) 100 ug
$436.00
TP303115 Recombinant protein of human cystatin A (stefin A) (CSTA), 20 µg 20 ug
$867.00
TP720597 Purified recombinant protein of Human cystatin A (stefin A) (CSTA) 10 ug
$235.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products