OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RWDD2B (NM_016940) Human Mass Spec Standard

Be the first to review this product
SKU
PH303057
RWDD2B MS Standard C13 and N15-labeled recombinant protein (NP_058636)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY413791 Transient overexpression lysate of RWD domain containing 2B (RWDD2B) (as WB positive control) 100 ug
$436.00

Other products for "RWDD2B or NM_016940"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203057
Predicted MW 36.3 kDa
Protein Sequence
Protein Sequence
>RC203057 protein sequence
Red=Cloning site Green=Tags(s)

MKIELSMQPWNPGYSSEGATAQETYTCPKMIEMEQAEAQLAELDLLASMFPGENELIVNDQLAVAELKDC
IEKKTMEGRSSKVYFTINMNLDVSDEKMAMFSLACILPFKYPAVLPEITVRSVLLSRSQQTQLNTDLTAF
LQKHCHGDVCILNATEWVREHASGYVSRDTSSSPTTGSTVQSVDLIFTRLWIYSHHIYNKCKRKNILEWA
KELSLSGFSMPGKPGVVCVEGPQSACEEFWSRLRKLNWKRILIRHREDIPFDGTNDETERQRKFSIFEEK
VFSVNGARGNHMDFGQLYQFLNTKGCGDVFQMFFGVEGQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_058636
RefSeq Size 1712
RefSeq ORF 957
Synonyms C21orf6; GL011
Locus ID 10069
UniProt ID P57060
Cytogenetics 21q21.3
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RWDD2B" proteins (3)
SKU Description Size Price
LC413791 Lyophilized RWDD2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413791 Transient overexpression lysate of RWD domain containing 2B (RWDD2B) (as WB positive control) 100 ug
$436.00
TP303057 Recombinant protein of human RWD domain containing 2B (RWDD2B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products