QPRT (NM_014298) Human Mass Spec Standard
CAT#: PH302960
QPRT MS Standard C13 and N15-labeled recombinant protein (NP_055113)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202960 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC202960 protein sequence
Red=Cloning site Green=Tags(s) MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGILAGQPFFDAIFTQLNCQ VSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKT TPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFALKVEVECSSLQEAVQ AAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD FSLKLFAKEVAPVPKIH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055113 |
RefSeq Size | 1575 |
RefSeq ORF | 891 |
Synonyms | HEL-S-90n; QPRTase |
Locus ID | 23475 |
UniProt ID | Q15274, V9HWJ5, B4DDH4 |
Cytogenetics | 16p11.2 |
Summary | This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402307 | QPRT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402307 | Transient overexpression lysate of quinolinate phosphoribosyltransferase (QPRT) |
USD 436.00 |
|
TP302960 | Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT), 20 µg |
USD 867.00 |
|
TP720230 | Recombinant protein of human quinolinate phosphoribosyltransferase (QPRT) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review