OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PLA2G12A (NM_030821) Human Mass Spec Standard

Be the first to review this product
SKU
PH302955
PLA2G12A MS Standard C13 and N15-labeled recombinant protein (NP_110448)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410681 Transient overexpression lysate of phospholipase A2, group XIIA (PLA2G12A) (as WB positive control) 100 ug
$436.00

Other products for "PLA2G12A or NM_030821"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202955
Predicted MW 20.9 kDa
Protein Sequence
Protein Sequence
>RC202955 representing NM_030821
Red=Cloning site Green=Tags(s)

MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDG
SKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQ
KTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_110448
RefSeq Size 1699
RefSeq ORF 567
Synonyms GXII; PLA2G12; ROSSY
Locus ID 81579
UniProt ID Q9BZM1
Cytogenetics 4q25
Summary Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s (Gelb et al., 2000 PubMed 11031251).supplied by OMIM, Mar 2008
Protein Families Druggable Genome, Secreted Protein
Protein Pathways alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PLA2G12A" proteins (4)
SKU Description Size Price
LC410681 Lyophilized PLA2G12A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410681 Transient overexpression lysate of phospholipase A2, group XIIA (PLA2G12A) (as WB positive control) 100 ug
$436.00
TP302955 Recombinant protein of human phospholipase A2, group XIIA (PLA2G12A), 20 µg 20 ug
$867.00
TP701054 Purified recombinant protein of Human phospholipase A2, group XIIA (PLA2G12A), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products